PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan019583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family HB-other
Protein Properties Length: 292aa    MW: 32945.5 Da    PI: 7.7512
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-37738PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.21.8e-153471357
               HHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox 13 eeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               ++Le+ + +++yps+++r++L+  lgLt+rq ++WF+ rR k+kk
  Aan019583  3 RQLEKTYLSEMYPSETTRAKLSVDLGLTDRQLQMWFCHRRLKDKK 47
               78*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.8E-5152IPR001356Homeobox domain
PROSITE profilePS5007114.511148IPR001356Homeobox domain
PfamPF000466.1E-13347IPR001356Homeobox domain
CDDcd000861.10E-8342No hitNo description
SuperFamilySSF466893.55E-12350IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-13347IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
XARQLEKTYL SEMYPSETTR AKLSVDLGLT DRQLQMWFCH RRLKDKKEDK KEVTLQRPVG  60
ENMDLMRSSQ QQLMVVERGG GSDHGSRLSS RHESMSRSRS RSVSGSGSGS ESDSSEDNEP  120
MGHSRAYELT QQNMMRRRII ECVEMQLGES LRKDGPELGI EFDELPPGAF GMPIVPKKRH  180
SQNRHSYEGN LYDQPPIKIE AGGRNIKHEP YGAASRSYGS PSGYASDQRL LLQNGLQPPY  240
ATARQLKGEM GHLSSPINDN AYNLPSEEVM QMWRKRKSEE GVAGLDGHSE KE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14047RRLKDKKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XF132e-82A0A103XF13_CYNCS; DDT domain-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.12e-29homeobox-1